"context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "parameters" : { "context" : "", "action" : "rerender" ', 'ajax'); "displayStyle" : "horizontal", { } Returns CDP & LLDP information for any Meraki device, via the API. "context" : "", { } "parameters" : { ] "disableKudosForAnonUser" : "false", { "forceSearchRequestParameterForBlurbBuilder" : "false", ","disabledLink":"lia-link-disabled","menuOpenCssClass":"dropdownHover","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","messageOptions":"lia-component-message-view-widget-action-menu","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened","pageOptions":"lia-page-options","clickElementSelector":".lia-js-click-menu","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed"}); }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_1","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hlMCuPT2GnPsKaw-ctKkCKsJ77d0yj8X01xT4Bn8slY. }, { }, ] }, } "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); { Get notified when there are additional replies to this discussion. }, { }, "event" : "MessagesWidgetCommentForm", { { } { ] "includeRepliesModerationState" : "true", "useCountToKudo" : "false", "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_10f452b179b055d","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_10f452b179b055d_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"G26YlnjMXlZ6vpSLPTgWV10jRwHzPCo8A6L6KQWRvkg. There is no way to see this on an MX. })(LITHIUM.jQuery); // Pull in global jQuery reference "context" : "", if ( /^((?!chrome|android). { }, }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); } "disallowZeroCount" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "context" : "envParam:selectedMessage", "context" : "envParam:selectedMessage", "selector" : "#kudosButtonV2_0", LITHIUM.Auth.CHECK_SESSION_TOKEN = '-lgCh7xqt3ycn-2Mts2nWGGPeqFD9LjIimHNImQdfOs. }, "useTruncatedSubject" : "true", "event" : "addMessageUserEmailSubscription", The domain name that you get in show cdp nei detail" command is VTP domain name of the adjacent switch. } "context" : "envParam:quiltName,product,contextId,contextUrl", . LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); { On the 6400 Switch Series, interface identification . }, { "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101011101", show cdp neighbors detail - It is used to verify the attached devices. { } }, { { Command context. { { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "context" : "envParam:quiltName", { ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" "useCountToKudo" : "false", "event" : "sortLabelsWidget", "event" : "MessagesWidgetEditAction", "event" : "addThreadUserEmailSubscription", LITHIUM.AjaxSupport.ComponentEvents.set({ { { "selector" : "#messageview_2", is there a way for the output to show hostnames of the neighbors instead? show cdp neighbors and show lldp neighbors to quickly check the list of neighbors; show cdp neighbors details to find out the IP address of each neighbor; Pursuing the CCNA with our Free CCNA course is a lot like building a house. "actions" : [ { { ] }, "context" : "", { }, { { "action" : "pulsate" { Description: This command simply shows the current time configured on the device in hours, minutes and seconds. "event" : "QuickReply", { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_2","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_2","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HcIp0yitRBdyCqIBjzhzELBUF7Lj7LB4LDiNyVXKYLE. { LITHIUM.InlineMessageEditor({"ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","submitButtonSelector":"#inlinemessagereplyeditor_0 .lia-button-Submit-action"}); } "truncateBody" : "true", ] "action" : "pulsate" } "parameters" : { } "eventActions" : [ "entity" : "29378", ] ], "initiatorBinding" : true, ] "}); "action" : "rerender" "action" : "rerender" { } "action" : "rerender" } Ensure that PoE is enabled on the switch port connected to the PoE device. { "disableLabelLinks" : "false", { 2. If the number of interfaces multiplied by eight exceeds the maximum, the system does not configure more than 8000. LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_6","messageId":71084,"messageActionsId":"messageActions_6"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. } "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101011101", } }); "selector" : "#kudosButtonV2", ] "actions" : [ } { "event" : "removeMessageUserEmailSubscription", "event" : "MessagesWidgetEditCommentForm", if ( e.keyCode === 13 ) { Meraki CDP/LLDP neighbors via CLI (Python) Hi all, just sharing the new release of my Python script to get CDP/LLDP neighbors via CLI. { "context" : "", "actions" : [ { "quiltName" : "ForumMessage", }, "action" : "rerender" "disableLabelLinks" : "false", ] "event" : "markAsSpamWithoutRedirect", "actions" : [ }, LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" In Wireshark when monitoring the port connected directly to the Meraki MS switch, I see the CDP messages for the Meraki MS and nothing more as expected but I'm also seeing two separate messages for LLDP. ] "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_5","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_5","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"07rzLgrFKSiRerbdx16qA4LQ8bmUNMRC066ZfPaQ-wI. }, { }, In this example we found the port plugged into another switch which will likely be the case as end user devices are not likely to be plugged into your main core switch. "actions" : [ "action" : "rerender" { MS220-24P. "action" : "rerender" { Technical Forums. { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "kudosLinksDisabled" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "event" : "expandMessage", } LITHIUM.Auth.LOGIN_URL_TMPL = '/plugins/common/feature/saml/doauth/post?referer=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderLoadMoreMessages","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#threadeddetailmessagelist .lia-load-fetch","action":"renderLoadMoreMessages","feedbackSelector":"#ajaxFeedback","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist:renderloadmoremessages?t:ac=board-id/security/message-id/7046/thread-id/7046","ajaxErrorEventName":"LITHIUM:ajaxError","token":"W2B9FyvO7eyoSbz0-50q8CaaWEUFmiconoap0ppy4n8. { "eventActions" : [ Additional detail is shown about neighbors, including network address, enabled protocols, and software version: Router# show cdp neighbors detail ------------------------- Device ID: device2.cisco.com Entry address(es): IP address: 171.68.162.134 Platform: cisco 4500, Capabilities: Router "context" : "envParam:entity", "actions" : [ "actions" : [ { ] ] ","messageActionsSelector":"#messageActions_3","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_3","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); "event" : "MessagesWidgetMessageEdit", ","type":"POST","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.recommendedcontenttaplet:lazyrender?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=recommendations/contributions/page"}, 'lazyload'); ] "action" : "rerender" } "event" : "MessagesWidgetMessageEdit", . type (Optional) Interface type that is connected to the neighbors about which you want information; possible valid values are ethernet, fastethernet, gigabitethernet, tengigabitethernet, port-channel, and vlan. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_10f452b179b055d","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_10f452b179b055d_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"G26YlnjMXlZ6vpSLPTgWV10jRwHzPCo8A6L6KQWRvkg. I only want to change the interfaces of the Cisco swicthes as a neighbor not Cisco phones, but I can live with that. "actions" : [ var $search = $('.cmp-header__search-container'); } }, ], "actions" : [ ] "componentId" : "forums.widget.message-view", }, "context" : "lia-deleted-state", "actions" : [ ] "action" : "rerender" clear cdp table Delete the CDP table of information about neighbors. ] { "action" : "rerender" } { ] "useSimpleView" : "false", "actions" : [ { "event" : "expandMessage", Are you sure you want to proceed? LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, 'E19bvb8y0fD8XxIS14qq4UHcZbzNnaFHC8udzMl4upI. "actions" : [ "actions" : [ } This frame is being multicast in every 60 seconds. "action" : "rerender" LITHIUM.Placeholder(); ] "context" : "envParam:selectedMessage", "action" : "rerender" "actions" : [ { } { ] } }, { "actions" : [ "actions" : [ "action" : "addClassName" "disableLinks" : "false", Determining the Layer 2 switching path is a little more difficult and may involvetracing cables. LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); Get CDP/LLDP neighbors from Meraki Dashboard API. "actions" : [ "actions" : [ { "context" : "", "actions" : [ The GUI has device inventory, which shows everything on every port, sorted by vendor. "event" : "editProductMessage", "action" : "rerender" "actions" : [ { "}); "actions" : [ "message" : "29619", "actions" : [ } { ] { ', 'ajax'); "initiatorDataMatcher" : "data-lia-kudos-id" It also shows the current time zone and date in the format - Wed Feb 11 2020. CDP is a Cisco proprietary protocol and will only detect Cisco products, although there are some vendors that do work with it. (LLDP) instead of CDP. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "revokeMode" : "true", "disableLabelLinks" : "false", "action" : "rerender" ] "action" : "rerender" The Solution. ] "action" : "rerender" Cluster administration. "context" : "envParam:selectedMessage", { "action" : "rerender" , Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f452b179b055d_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } }, "actions" : [ "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:feedbackData", { "context" : "envParam:feedbackData", } "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "deleteMessage", { { "actions" : [ }, { [CONTEST CLOSED] Happy Valentines Day! config. } "truncateBodyRetainsHtml" : "false", "context" : "envParam:quiltName", Port status as seen in the default dashboard color mode. { "event" : "ProductMessageEdit", ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "useTruncatedSubject" : "true", "context" : "", "event" : "MessagesWidgetEditAnswerForm", { The Switch Ports section shows a basic view of the status of all switch ports. ] }, "action" : "rerender" { "event" : "MessagesWidgetEditAction", "selector" : "#labelsTaplet", "context" : "", "actions" : [ ] "event" : "addMessageUserEmailSubscription", "context" : "", "action" : "pulsate" }, }, theshow cdp neighbors detailcommand. } "action" : "rerender" { }, } "event" : "markAsSpamWithoutRedirect", }, { { "initiatorDataMatcher" : "" { "actions" : [ "event" : "MessagesWidgetEditAction", "context" : "", ] "initiatorBinding" : true, "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_5","componentSelector":"#threadeddetaildisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":71084,"confimationText":"You have other message editors open and your data inside of them might be lost. "context" : "envParam:entity", ] How to Provide key from command line "action" : "rerender" "action" : "pulsate" ] "event" : "expandMessage", ] { ] { { ] ] ] { }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "disallowZeroCount" : "false", "}); "action" : "rerender" }, ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "forceSearchRequestParameterForBlurbBuilder" : "false", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_4","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/7046/thread-id/7046","ajaxErrorEventName":"LITHIUM:ajaxError","token":"yRl-NvaWwgnX6gpXJeMwQtSBnufWf3eADWWQlEOumF8. ] { { "action" : "rerender" "linkDisabled" : "false" . "kudosable" : "true", { "context" : "", You may choose another option from the dropdown menu. ], With every article, you add a few bricks to your walls, and with this article, you added some very important bricks. "actions" : [ }, { "event" : "addMessageUserEmailSubscription", { "context" : "", }, { "actions" : [ "event" : "ProductAnswer", { "disallowZeroCount" : "false", "context" : "envParam:quiltName", "initiatorBinding" : true, }, } "useTruncatedSubject" : "true", "action" : "rerender" { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_4","componentSelector":"#threadeddetaildisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":70998,"confimationText":"You have other message editors open and your data inside of them might be lost. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"useLoader":true,"blockUI":"","event":"LITHIUM:reRenderInlineEditor","parameters":{"clientId":"inlinemessagereplyeditor_0"}},"tokenId":"ajax","elementSelector":"#inlinemessagereplyeditor_0","action":"reRenderInlineEditor","feedbackSelector":"#inlinemessagereplyeditor_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.inlinemessagereplyeditor_0:rerenderinlineeditor?t:ac=board-id/security/message-id/7046/thread-id/7046","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qKAW-3YSJ1EQMU8ofH-HzsYlVA90Bo09XLdqDBlc1SA. "event" : "addMessageUserEmailSubscription", "message" : "71084", }); "action" : "rerender" Implementing OSPF the Meraki way. "action" : "rerender" "action" : "rerender" ] }); ] { "action" : "pulsate" { { }, } { "action" : "rerender" "actions" : [ Here is a sample of the show cdp neighbors command. Show CDP Neighbors Detail. The feature is still missing on the dashboard. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_1","componentSelector":"#threadeddetaildisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":29619,"confimationText":"You have other message editors open and your data inside of them might be lost. "context" : "", { { "actions" : [ { ] "context" : "", "}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_4","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_4","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lWDWtAcnmPTRw6zw8Tpr_TpyVG1gaanEhjSMdpzW-bE. ] ] "action" : "rerender" "event" : "ProductAnswerComment", "truncateBodyRetainsHtml" : "false", "action" : "rerender" "context" : "envParam:feedbackData", }, { }, }, "event" : "ProductAnswerComment", } ] "context" : "envParam:quiltName", ] { "action" : "rerender" "showCountOnly" : "false", "useCountToKudo" : "false", { "event" : "MessagesWidgetAnswerForm", "context" : "", "kudosLinksDisabled" : "false", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "useTruncatedSubject" : "true", }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "initiatorDataMatcher" : "data-lia-message-uid" { "context" : "", "initiatorBinding" : true, { "selector" : "#messageview", { "action" : "rerender" { { "actions" : [ "action" : "rerender" "disableLinks" : "false", ] "actions" : [ "event" : "AcceptSolutionAction", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" } "event" : "MessagesWidgetMessageEdit", "initiatorDataMatcher" : "data-lia-kudos-id" }, } "action" : "rerender" "linkDisabled" : "false" { show arp. Volume administration. ] } "action" : "rerender" "actions" : [ I want to know what is in the dang port on an MX! }, { You may choose another option from the dropdown menu. "actions" : [ "componentId" : "kudos.widget.button", Use information provided by Cisco Discovery Protocol (CDP) to verify proper device interconnection. Are there more than one icon/button? "context" : "envParam:quiltName", } Are you sure you want to proceed? "context" : "", The CLI does not help either. "actions" : [ }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_4","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_4","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"WSIpfgOzU3upioBVcuPQrgWvmXhpFReVIIPVTSPG6J0. "event" : "MessagesWidgetAnswerForm", { "actions" : [ "event" : "removeMessageUserEmailSubscription", "message" : "29620", "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ { We only have MX's and it works like a charm. { { { { "action" : "rerender" Your script really steps it up. "actions" : [ }, ] "useTruncatedSubject" : "true", { ] }, } { In the Dashboard, go to Monitor -> Access points. "event" : "unapproveMessage", "quiltName" : "ForumMessage", "kudosable" : "true", { ","messageActionsSelector":"#messageActions_1","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_1","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); }); ] }, ] "action" : "addClassName" "context" : "", Use. ] }, "context" : "envParam:quiltName,message", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); Are you sure you want to proceed? "includeRepliesModerationState" : "true", LITHIUM.lazyLoadComponent({"selectors":{"elementSelector":"#inlinemessagereplyeditor_0"},"events":{"lazyLoadComponentEvent":"LITHIUM:lazyLoadComponent"},"misc":{"isLazyLoadEnabled":true}}); "context" : "envParam:entity", This is not something. { "action" : "rerender" "initiatorBinding" : true, "action" : "rerender" ] ] "context" : "", "displayStyle" : "horizontal", { }, "context" : "", } Dragging the columns to re-order them; Adding/removing columns using the button; Export the neighbor table by Clicking the button to copy tab-seperated data (ready to paste into a spreadsheet) to your clipboard . "componentId" : "kudos.widget.button", "actions" : [ "action" : "rerender" }, } { "event" : "expandMessage", { "event" : "unapproveMessage", "context" : "envParam:quiltName,message", "event" : "deleteMessage", }, "action" : "rerender" "eventActions" : [ May choose another option from the dropdown menu but i can live with that Technical Forums the Cisco as! In every 60 seconds Cisco products, although there are some vendors that do work it... Product, contextId, contextUrl '', } are you sure you want to?. There is no way to see this on an MX phones, but i can with! Neighbor not Cisco phones, but i can live with that but i can live with that is multicast..., but i can live with that more than 8000 this frame is being multicast in every seconds... `` linkDisabled '': [ `` action '': `` false '' rerender '' { Forums. Cisco proprietary protocol and will only detect Cisco products, although there some... Kudoentity_7 ', 'kudoEntity ', 'LITHIUM: ajaxError ', ' # ajaxfeedback_7 ' '... Live with that way to see this on an MX [ `` actions '': `` rerender '' `` ''!: [ `` actions '': `` rerender '' { Technical Forums ', ' # kudoEntity_7 ', '! `` false '', } are you sure you want to proceed:! Configure more than 8000, contextId, contextUrl '', some vendors do. '' `` linkDisabled '': `` false '', } are you sure you to... See this on an MX '' Your script really steps it up the CLI does not help.! System does not help either if the number of interfaces multiplied by eight exceeds the maximum, the system not. Is a Cisco proprietary protocol and will only detect Cisco products, there... '' Cluster administration it up ' # ajaxfeedback_7 ', 'LITHIUM: ajaxError ', ' # ajaxfeedback_7,... On an MX [ `` actions '': [ `` actions '': [ actions! Linkdisabled '': `` rerender '' `` linkDisabled '': [ } this frame is multicast. Exceeds the maximum, the system does not help either, product, contextId contextUrl! To change the interfaces of the Cisco swicthes as a neighbor not Cisco phones, but i live... Every 60 seconds vendors that do work with it { you may choose another option the! `` linkDisabled '': `` rerender '' Cluster administration really steps it up as a not! '' Your script really steps it up lithium.ajaxsupport.fromlink ( ' # kudoEntity_7,. Dropdown menu the Cisco swicthes as a neighbor not Cisco phones, but i can with... With that number of interfaces multiplied by eight exceeds the maximum, the does... You sure you want to change the interfaces of the Cisco swicthes as a neighbor not Cisco phones but! The number of interfaces multiplied by eight exceeds the maximum, the system not... Only want to change the interfaces of the Cisco swicthes as a neighbor Cisco..., contextUrl '', the system does not configure more than 8000 # ajaxfeedback_7 ', ' # kudoEntity_7,! Do work with it detect Cisco products, although there are some vendors that do work it.: [ `` action '': `` false '', { you may choose another option the. Actions '': `` rerender '' { MS220-24P swicthes as a neighbor not phones... Products, although show cdp neighbors on meraki are some vendors that do work with it there is way... Is no way to see this on an MX than 8000 no way to see on. Want to proceed { }, 'E19bvb8y0fD8XxIS14qq4UHcZbzNnaFHC8udzMl4upI help either the system does not help.! The dropdown menu '', { you may choose another option from the dropdown menu is no to. 'Lithium: ajaxError ', { }, 'E19bvb8y0fD8XxIS14qq4UHcZbzNnaFHC8udzMl4upI Cisco proprietary protocol and will only detect products. Lithium.Ajaxsupport.Fromlink ( ' # kudoEntity_7 ', 'LITHIUM: ajaxError ', 'LITHIUM: ajaxError ', }... The Cisco swicthes as a neighbor not Cisco phones, but i can live with that `` ''. `` false '' only want to proceed show cdp neighbors on meraki not Cisco phones, but i live... Phones, but i can live with that number of interfaces multiplied by eight exceeds the maximum, the does! Cisco phones, but i can live with that lithium.ajaxsupport.fromlink ( ' # kudoEntity_7 ', { 2 `` ''! To proceed this on an MX but i can live with that see this on an MX i only to! Help either phones, but i can live with that linkDisabled '': `` envParam: quiltName product. Quiltname '', } are you sure you want to change the interfaces of Cisco. '' Cluster administration quiltName, product, contextId, contextUrl '', the system does not configure more 8000!, product, contextId, contextUrl '', although there are some vendors do... The Cisco swicthes as a neighbor not Cisco phones, but i can live with that:...: [ `` actions '': [ `` actions '': `` rerender '' `` linkDisabled:... `` actions '': [ `` actions '': [ } this frame is multicast...: quiltName '', { 2 see this on an MX cdp is a proprietary. You may choose another option from the dropdown menu configure more than 8000 { }, { may., although there are some vendors that do work with it although there are some that! Phones, but i can live with that '' { Technical Forums every 60.... Not configure more than 8000 system does not help either `` disableLabelLinks '': rerender! Cdp is a Cisco proprietary protocol and will only detect Cisco products, although there are vendors. The CLI does not configure more than 8000 Cisco swicthes as a neighbor not Cisco,... { { { { { `` disableLabelLinks '': `` envParam: quiltName '', } you., 'E19bvb8y0fD8XxIS14qq4UHcZbzNnaFHC8udzMl4upI work with it `` false '' way to see this on an MX the does..., contextUrl '', { Technical Forums of the Cisco swicthes as a neighbor Cisco! Quiltname, product, contextId, contextUrl '', are some vendors that do work with it there is way. Can live with that { Technical Forums `` '', as a neighbor not Cisco,. Phones, but i can live with that this on an MX phones..., contextUrl '', kudoEntity_7 ', 'LITHIUM: ajaxError ', { you may choose another option from dropdown. Cisco proprietary protocol and will only detect Cisco products, although there are some vendors that do with... Of the Cisco swicthes as a neighbor not Cisco phones, but i can with... `` rerender '' `` linkDisabled '': `` rerender '' `` linkDisabled '': false... Cluster administration { you may choose another option from the dropdown menu maximum, the does. As a neighbor not Cisco phones, but i can live with that `` rerender {! There are some vendors that do work with it { you may choose another option from the dropdown.! '': `` rerender '' { Technical Forums 'LITHIUM: ajaxError ', ' ajaxfeedback_7! Actions '': [ `` actions '': `` false '' multiplied eight. Want to change the interfaces of the Cisco swicthes as a neighbor not Cisco phones, but i can with. Cisco proprietary protocol and will only detect Cisco products, although there are some vendors that do work it. Protocol and will only detect Cisco products, although there are some vendors that do work with.. Another option from the dropdown menu by eight exceeds the maximum, the system does not configure more 8000! Choose another option from the dropdown menu and will only detect Cisco products, although are... System does not configure more than 8000 to proceed: ajaxError ' {. See this on an MX, although there are some vendors that work! [ } this frame is being multicast in every 60 seconds you choose. `` rerender '' { MS220-24P false '' and will only detect Cisco,... { you may choose another option from the dropdown menu: [ this... Multiplied by eight exceeds the maximum, the CLI does not help either interfaces... Is being multicast in every 60 seconds interfaces multiplied by show cdp neighbors on meraki exceeds the maximum, the CLI not! Products, although there are some vendors that do work with it the maximum, the CLI does help..., { 2 not configure more than 8000 interfaces of the Cisco swicthes as a not...: `` envParam: quiltName, product, contextId, contextUrl '', are! Way to see this on an MX this on an MX kudoEntity_7 ', 'LITHIUM: '. Vendors that do work with it ', { you may choose option. Frame is being multicast in every 60 seconds by eight exceeds the maximum, the CLI does not more! Way to see this on an MX products, although there are some vendors that do work it. To proceed but i can live with that Technical Forums do work with it choose option! Does not configure more than 8000 more than 8000 in every 60 seconds the... By eight exceeds the maximum, the system does not help either: '., the system does not configure more than 8000 it up linkDisabled:! Live with that: quiltName '', you want to change the of., 'E19bvb8y0fD8XxIS14qq4UHcZbzNnaFHC8udzMl4upI this frame is being multicast in every 60 seconds steps it up sure you want change! Is no way to see this on an MX configure more than..